ADVERTISEMENT

It’s common sense to not trust everything that you read on the internet. After all, it doesn’t take a degree or any sort of qualifications to start publishing articles on topics that you know nothing about. Whether you intend on starting conspiracy theories or you’re inadvertently spreading misinformation, it’s extremely easy to make false claims online.

But thankfully, there are also plenty of people who are quick to call out ridiculous statements that they come across on the internet. We took a trip to the Bad Medical Takes account on X and gathered some of their best posts below. This page is dedicated to stopping medical information in its tracks, so enjoy scrolling through these absurd claims and pieces of advice. And remember: you probably shouldn't trust anyone with your health except your doctor!

#1

Screenshot of a tweet incorrectly spreading medical knowledge about blood transfusions and sea water usage during WW1.

BadMedicalTakes Report

Nathaniel He/Him Cis-Het
Community Member
Premium
16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

Personally I just use essential oils.

laura lee
Community Member
14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

During wartime? You gotta conserve, I only use nonessential oils

Load More Replies...
Lotekguy
Community Member
Premium
11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

No. It's bleach. Try it! You'll like it!

Scott Rackley
Community Member
10 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

Only if you add bleach to the seawater

Angela Corvaia
Community Member
Premium
2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

Didn’t “they” use this as experiments on prisoners during WW2? Not a good reference.

Val
Community Member
8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

How do hospitals feel about AB negative blood?

View more comments
RELATED:
    #2

    Tweet with a photo about women choosing to be single by 2030, example of people spreading medical knowledge and getting shamed.

    BadMedicalTakes Report

    Am I Funny? Maybe or maybe not
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If 50 percent of women are single, doesn't it make 50 percent of men single too. (Ignoring situations like homosexuality and polyamoury)

    LB
    Community Member
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes but the important part here is "by choice"

    Load More Replies...
    The Short Lady
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don't know but I'm guessing Richard and Bill will be alone till the end.

    Sue User
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sounds like Bill is " begging the question" . That he knows it's all just doom and gloom and we are avoiding it.

    Load More Replies...
    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    BULL SHITE I’m happily single now thank you 14 years now and it’s BLISS , we do not need men to define us , or a partner of either gender ,

    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Their life choice of being single by choice 🙄

    Whatshername
    Community Member
    6 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Welp, the doom is not really impending anymore, is it? Get your head out your ārsē Bill

    David Morgan
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm surprised at this stat. Judging by the nonsense spewed here, I'd have thought that virtually every woman Richard meets would tell him they already have a partner and are definitely not interested...

    Flat_Alien
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If that happens, 50 percent of men will be incels

    Laszlo Larthlanc
    Community Member
    21 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Single by choice doesn't mean that a person can't have friends of the opposite gender. It can also mean that they're just keeping their home lives separate and mostly private, and that they're not tying themselves in knots trying to please another person.

    The Chronic Insomniac
    Community Member
    53 minutes ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Could it be that women can finally have some autonomy? Could it be that having children is exorbitantly expensive these days?

    View more comments
    #3

    Screenshot of Twitter discussion showing flawed medical knowledge about therapy and gender roles, criticized for spreading misinformation.

    BadMedicalTakes Report

    keyboardtek
    Community Member
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Most of women's emotional issues are caused by men that never got any therapy.

    David Morgan
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    For example, Matt Walsh. I'm almost convinced that he's just an agitator - I struggle to believe that people that stupid exist today.

    Load More Replies...
    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Matt Walsh. Where does he lie in the top ten list of the biggest twatbaskets in the world.

    8Yorkies-and-33cats
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Freud was a liberal woman?! The things you learn on the Internet.

    Tamra
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    He just described why 50% of women will be single by choice. Dumba$$.

    kikinlivi
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    He should say exactly that to his new therapist. Then they can start to unpack

    Flat_Alien
    Community Member
    2 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ah, yes go listen to red pill coaches, it's better /s

    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Wow, misogyny at its best 🤬feels are feelings as are emotions makes no difference if they from a man or a woman we all have them ( bar sociopaths) oh n loads of men re also therapists to

    View more comments

    No matter what you’re going on the internet to find, you should proceed with caution. If you’re joining a new social media platform to make friends, you should know that you can’t always trust that other people are who they say they are. If you’re looking for the “best” vegan chocolate cake recipe, there are going to be dozens that swear they’re the greatest ever. And, of course, if you’re in search of health advice, don’t blindly believe what you read, even if the author claims to be a doctor.

    ADVERTISEMENT

    The Bad Medical Takes account on X makes it very clear that plenty of ignorant people feel comfortable spreading medical misinformation online. This page has amassed an impressive 275K followers by posting hilarious and concerning claims celebrities and random citizens alike have shared on the internet. Unfortunately, we can’t stop them from posting ignorant things, but we can shame them for it!      

    #4

    Tweet from Katie Miller sharing a misleading medical claim about vaccination with media site headline, illustrating medical knowledge spread.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    RFK the Brainworm's bad "advice"

    cugel.
    Community Member
    10 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    But he might get IV, possibly V

    WindySwede
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    They probably mean 'Yoachts', they would both even know what a 🚣‍♂️ is?

    Load More Replies...
    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yeah we won’t be listening to that maggot antivax lunatic will we 🙄

    Billo66
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's plausible. Sounds like she has sh­it in hers.

    Rick Murray
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And then one day the clostridium tetani bacteria will be like "oh, hello!". Don't look up what it does when it gets hold, it's a bit nightmare fuel. If only there was some way of educating the body's immune system what this thing is so it can nuke it on sight rather than.......

    HamsterGirl
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Vaccines are still important! Think of all those germs in the dirt. 🤮🤮

    Ace
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Most harmful 'germs' will not be in the dirt, but in other people. The 'eat a peck of dirt a day' idea is a nonsense in any case, but proliferates the false idea that 'dirt', or soil, earth as Brits would call it, is inherently harmful and germ-ridden.

    Load More Replies...
    tameson
    Community Member
    4 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    "The Environmental Protection Agency (EPA) estimates that young children consume on average 200 to 800 mg of dirt daily." Not a big deal and it can actually help develop the immune system.

    Flat_Alien
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And I could put dirt in her head to fill space from her missing brain

    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Isn't feeding your child dirt a***e 🤔

    View more comments
    #5

    Twitter exchange showing a medical expert correcting dangerous natural remedy claims, highlighting medical knowledge spread and shaming.

    BadMedicalTakes Report

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And why isn't there enough karmic justice when these morons get ill, like when all those deniers died of covid?

    joann fielding
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This thread is full of Darwin Award candidates.

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh Gina... You sweet, dumb, summer child

    LizzieBoredom
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oregano? Wasn't Italy hard hit by COVID?

    Rick Murray
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Always a natural remedy? So what's the remedy for cancer? Gotta be something better than blasting people with radiation and freaky chemicals on the hope that there's more good tissue than bad so the patient ought to survive it. Should be be, I dunno, knocking back avocado smoothies or something? Is that what we're doing wrong?

    Auntriarch
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    She's absolutely right, there is always a natural remedy. Of course it probably won't work

    Load More Replies...
    Kim Gatlin
    Community Member
    1 minute ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    There is a natural remedy. It's called death.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I’m going to go out on a limb here and point out that there *could* be simple alternatives in nature for many medications, but as no one can make a profit from them and it costs millions to prove that a treatment works and is safe, with our current free market model we are never going to find them. I’m not therefore suggesting treating meningitis in children with oregano capsules. But I do feel we’re missing out.

    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Omfg , look herbal stuff is brilliant , I use it a lot ALONG SIDE western medicine for both myself and my animals , oregano on its own WILLL NOT CURE ANYTHING 🙄🙄makes the food u eat takes lovely mind lol but it will NOT cure you ,and it most defo is NOT a f kin antibiotic, people like that one downright dangerous !! Oh and if you want to use herbal remedies along side western medicine, always consult a doctor that is well up on them . Back in the day , it was idiots like op as got us witches drowned hung , n occasionally burned at the stake !

    Auntriarch
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Lush made a soap a few years ago with oregano, apparently it was more effective than ordinary soap.

    Load More Replies...
    View more comments
    #6

    Screenshot of a Twitter post sharing medical knowledge about freckles and skin aging, facing criticism and shaming online.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    How can you test it if you have never been with a woman?

    G A
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Vish Burra and his Big Incel Book of Women's Medical Knowledge

    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A body she "caught"??? Like a spider in her web? That's so vague I can't understand in which way he doesn't make any sense at all.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Do they mean "a person she had séx with", perhaps? (as "body count" can sometimes refer to the number of séxual partners one has had.) I'd love to see VishBurra's scientific "proof", as I'm 43 years old, have tons of freckles/spots/moles on my face, but have only slept with 3 different men in my entire life XD

    Load More Replies...
    Maggz Bennett
    Community Member
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Because celibate nuns are famously unblemished in older age. 🙄

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Or so the nuns claim. But now we know the truth, all thanks to Vish and his expertise in dermatological research!

    Load More Replies...
    Bartlet for world domination
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Okay I used good lighting and I wore my best glasses but I definitely have fewer freckles than bodies. Men beware!

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What. The. Heck. Is. This. Person. Talking. About.

    V
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If this was true I would be then Bonny Blue wouldn't hold a candle to me. Or it could just be that I'm genetically predisposed to age and sun spots.

    My O My
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Bonny Blue would just be one big spot

    Load More Replies...
    Miki
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Holy f̷u̵c̷k̸. That's new.

    Daisydaisy
    Community Member
    Premium
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh this is hilarious!

    View more comments
    ADVERTISEMENT

    As I’m sure you know, social media is a goldmine for misinformation. So it’s no surprise that influencers are happy to spread false claims about health as well. One 2025 study of the top 100 mental health TikToks found that more than half contained misinformation.

    Another issue with content on social media that discusses mental health is the fact that these videos tend to over-generalize and minimize the complexity of various health issues.

    Amber Johnston, a British Psychological Society-accredited psychologist who reviewed the videos discussing trauma, told The Guardian, “Each video is guilty of suggesting that everyone has the same experience of PTSD with similar symptoms that can easily be explained in a 30-second reel. The truth is that PTSD and trauma symptoms are highly individual experiences that cannot be compared across people and require a trained and accredited clinician to help a person understand the individual nature of their distress.”

    #7

    Tweet conversation spreading questionable medical knowledge about reproduction and gender linked to physical traits, shamed online.

    BadMedicalTakes Report

    The Short Lady
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Neither of them has the brain of a low IQ lima bean.

    kikinlivi
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Leave Lima beans of this, they didn't do anything lol

    Load More Replies...
    G A
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Mark and Heidi-please never breed. Especially with each other.

    Mike F
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Man I'm glad I go no further into SM than BP! It's scary out there.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Mark's mother should have swallowed him.

    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yeah this whole list is booboo Twitter only has Morons on it anymore from the head twit to the bottom

    Victor Botha
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm here for the comments. You folks are hysterical 🤣

    Billo66
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's not the length it's the girth. I can hit both sides of a can of skoal, just can't touch bottom...

    Miki
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And if it's long enough, you will reach this special spot in a female body that produces Chads. 😉🙄 (/s)

    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Omg are these really our future ?? Yup we doomed 😱🤦‍♀️

    View more comments
    ADVERTISEMENT
    #8

    Twitter exchange where someone spreads questionable medical knowledge about childbirth, sparking criticism and shaming online.

    BadMedicalTakes Report

    laura lee
    Community Member
    14 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Still wasn't from childbirth, it was from being a w**s

    LakotaWolf (she/her)
    Community Member
    Premium
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I have to be honest, I don't really like that you refer to a person dying from a stroke caused by panic or stress as a "wúss", regardless of whether or not it's a man. It's not funny.

    Load More Replies...
    Billo66
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Being stubborn takes quite a few of us out too.

    kikinlivi
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Unpopular opinion, but seeing your loved one in pain and being absolutely unable to help is actually very stressful for a man. That fact in no way detracts from what the woman is experiencing. It's not a balance beam, both partners can have pain and distress at the same time.

    The Chronic Insomniac
    Community Member
    49 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That's hidden cardiovascular disease, sir.

    View more comments
    ADVERTISEMENT
    #9

    Tweet claiming microplastics are natural and harmless, spreading questionable medical knowledge and misinformation online.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm guessing Rich swallows Lego bricks for the health benefits.

    MoMcB
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I hope so, and it hurts when he passes them.

    Load More Replies...
    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I only trust locally sourced micro plastics. Some of them come from countries with no health standards at all.

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And that's why Rich started the "Tide Pod" challenge

    G A
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Rich thinks plastic flowers grow on astroturf

    Billo66
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Jimbo! Break out the me­th lab again. Apparently everything is safe now.

    Am I Funny? Maybe or maybe not
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Should I tell everyone that many plastics are organic.

    David Morgan
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Rich, since they are entirely naturally-occurring, feel free to ingest tetradotoxin, plutonium, lead, mercury and lava. Some of them have minerals in them. Yum yum.

    Rick Murray
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A while back the EU had to round up and ban some synthetic rubbish that was promoting itself as "all natural". The argument used was that "it exists, it exists in nature (ie reality), therefore it is natural". Uh, no, that's not what that word means.

    Auntriarch
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The trouble is that natural has more than one meaning, and the people who love the word the most are the easiest to con, by people who know exactly what it means

    Load More Replies...
    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Polymers were created in a lab by humans never once appearing on earth naturally before then

    WindySwede
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Perhaps I'm being nerdy, but cellulose is a organic polymer• But human created polymers on the other hand, are a nother thing• (Sorry 🤓🤓) (the • is instead of dots, to not risk get hidden comments)

    Load More Replies...
    Jaya
    Community Member
    1 minute ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Getting eaten by a bear is also natural, but I wouldn't trust any study that says getting eaten by a bear increases muscle growth. It does help you sleep better though, forever.

    View more comments

    Meanwhile, certain health trends that spread online can be extremely dangerous. For example, in 2023, some people were drinking Borax diluted with water in an attempt to treat arthritis and other health issues. And children as young as nine have been shown anti-vax TikToks, which might cause them to believe that vaccinations are harmful. This kind of medical misinformation can harm not only the people who are exposed to it, but their entire communities.      

    #10

    Twitter exchange discussing estrogen and progesterone as female hormones, illustrating medical knowledge spread and shaming.

    BadMedicalTakes Report

    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And are produced in the male body as well, just like women produce testosterone as well as men. Both just do it in lower amounts

    I am John
    Community Member
    1 hour ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hi Aswad, what do Estrogen, Progesterone and Testosterone do, exactly? I want pathways, protein structures, expression by tissue, regulatory elements and interaction partners please?

    David Morgan
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I bet this knucklehead refuses to believe that men and women share 50% of their chromosomes - after all, the X chromosome is for women.../s

    ADVERTISEMENT
    #11

    Screenshot of a social media post spreading questionable medical knowledge, relevant to medical knowledge shaming topics.

    BadMedicalTakes Report

    Ace
    Community Member
    Premium
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I remember having surgery in Derby Children's Hospital in 1966. It was far from new at that point.

    Steven Francis
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Children's Hospital of San Francisco (the city in which Rob was born) was opened in 1875...I guess he's looking good for 151+ years old

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The first children's hospital is the Hôpital des Enfants-Malades, founded in 1802 in Paris, which was specifically established for the treatment of sick children. In the United States, the Children’s Hospital of Philadelphia (CHOP) opened in 1855 and was the first hospital dedicated to treating illnesses and injuries specific to children.

    Did I say that out loud?
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And Great Ormand Street Hospital in London has been around since 1852.

    Load More Replies...
    Gingersnap In Iowa
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    St.Jude's Children Research Hospital was founded in 1962.

    Sue User
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yay Danny Thomas. Real name:Amos Muzyad Yaqoob Kairouz. Son of immigrants from Lebanon.

    Load More Replies...
    Lotekguy
    Community Member
    Premium
    11 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Children's Hospital in St Louis was founded in 1879. Too bad Rob didn't know about that. They might have helped him with his delusions of competency.

    Mike F
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I remember anneighbor girl who had a deformity in her hands. Her second home was Shriners for several years.

    Maggz Bennett
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So, in the years before penicillin, those high levels of childhood mortality were from kids in full health?? Shush now .

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Dookie Bigot-Low, Male P**o (Supporter)

    R Dennis
    Community Member
    17 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Our oldest, and largest, local children's hospital opened in 1886.

    View more comments
    #12

    Tweet from user Big Red sharing questionable medical knowledge about organ donation and hospital procedures, fitting medical knowledge shaming.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Shullbit of the highest order.

    Don Adams
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Agreed. I received a donor heart about 20 months ago. During my time in the hospital, before and after the transplant, I was amazed at the stringent guidelines that are followed. Unfortunately, posts like this have encouraged people to have Orhan Donor removed from their licenses. Save a life, be a donor!

    Load More Replies...
    Deborah B
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Dude, you were an orderly. You thought breathing on a vent meant "alive". Brain dead and breathing on a vent is exactly the scenario for which the Organ Donor ID is intended.

    Ace
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Quite so. Keeping the bodily functions going after the patient has been declared dead is often an essential part of the process.

    Load More Replies...
    Billo66
    Community Member
    Premium
    5 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    You fell asleep watching Hostel again moron. Was his donor ID a small tattoo of a Brazilian Mastiff?

    No one
    Community Member
    56 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sure, let's k**l someone to save a life

    View more comments

    The American Psychological Association also warns that medical misinformation online can cause financial harm as well. There are plenty of people and companies claiming that they have alternative medical solutions, when their real aim is only to make a profit by taking advantage of desperate and vulnerable people. If someone feels like they’ve been mistreated by the traditional medical system, they might be willing to try anything. But they should be skeptical of any individuals or products that make extraordinary claims.   

    #13

    Two men in a formal setting discussing medical knowledge during a vaccine advisory meeting on childhood vaccination changes.

    BadMedicalTakes Report

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    RFK. The only Kennedy who would survive a shot to the brain without effect

    V
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes, thanks to vaccines children live long enough to be diagnosed with allergies and autoimmune disorders.

    laura lee
    Community Member
    13 hours ago

    This comment is hidden. Click here to view.

    So I hear Canada lessened their rules on citizenship last month by ancestry to include great great grandparents. Just saying before we turn into Gilead

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Let me off this planet please

    Fish Face
    Community Member
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Don’t need to leave the planet; just the USA. The level of stupidity here is mind boggling.

    Load More Replies...
    TotallyNOTAFox
    Community Member
    14 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    And they actually went through with it, honestly how did that idiot get in charge not only without knowledge but actual harmful believes?

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Maybe they should research whether childhood vaccinations caused the rampant idiocy in the Trump administration.

    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The new policy. Stop protecting the children. Let some of them die. Then do the research, delegating it to people you expect will support your initial decision. Fire them if they don't.

    Miki
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Maybe they want to reduce the population?

    JB
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Then how do you explain the repeal of Roe v Wade and significant increase in legislation against termination?

    Load More Replies...
    JenC
    Community Member
    8 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ah yes, lets put children at risk of a lifelong chronic condition that could be easily prevented. For any naysayers, it's not just soread by d**g use or s*x. If your kid has a cut and gets infected blood or saliva in the wound, he can be infected.

    View more comments
    #14

    Tweet claiming modern wheat is genetically modified and alters DNA, an example of spreading false medical knowledge online.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Beware dihydrogen oxide, it's even more dangerous than GM foodstuffs.

    Ace
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    True. 100% of people who ingest it will die.

    Load More Replies...
    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hana doesn't eat breakfast cereal as she doesn't want to turn into Mystique

    Charlotte
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Huh. Now I'm thinking I should get me some of that cereal!

    Load More Replies...
    emorinelli49
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don’t get why people are so upset about genetically modified foods. We’ve been doing this for hundreds of years.

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Longer than that, look at the history of corn for an example.

    Load More Replies...
    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So we should remake the film Gattaca and call it Wheat?

    LakotaWolf (she/her)
    Community Member
    Premium
    8 hours ago

    This comment is hidden. Click here to view.

    WHEATTACA XD (as an aside, I really love that movie. GATTACA, not Wheat, lol.)

    Load More Replies...
    Am I Funny? Maybe or maybe not
    Community Member
    13 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    You can't literally change dna that easily in a living organism. You have to use gene scissors or induce variation during reproduction.

    WindySwede
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    We have been changing genes for 9000 - 11000 years already. We just have different tools now.

    Load More Replies...
    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    yes stop lol stop your scaremongering shite , u will be telling us the earth is flat next 🙄

    JenC
    Community Member
    7 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Modern dogs are also GMO, through generations of selective breeding.

    View more comments
    #15

    Screenshot of a Twitter post spreading medical misinformation about viruses, part of medical knowledge shaming examples.

    BadMedicalTakes Report

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yeah, by all means keep trusting video uploads from crackpots instead of, I don't know, talking to people who actually studies science and are experts

    Alex Kennedy
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It’s not actually necessary to talk to experts to determine if virii exist. There are plenty of papers on virii with methodology and results that can be understood with maybe a month’s reasonable study.

    Load More Replies...
    Savannah greenleaf
    Community Member
    Premium
    10 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I am a bit shocked that this individual survived long enough to reach adulthood. This level of moron can be incompatible with life.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I find myself asking myself that question in my head quite often about people these days - even my own mother and sister. "How did this person survive to adulthood?!"

    Load More Replies...
    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yeah, and "birds aren't real" either.

    Annik Perrot
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    As an old lady with a brain, I consider myself insulted by her pseudo.

    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    RFK Jr has a high level job waiting for you.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I think your old lady brain has had at least one stroke

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Or... now hear me out... nature is trying to get rid of us because we (humans) are to the planet what fleas and ticks are to a dog.

    JB
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    “Obviously do your own research…” all it takes is a medical degree (Dr), and, ideally, a PhD (uberDr) with a specialism in virology, then you can do actual research.

    joann fielding
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, she's got an appropriate username.

    Rick Murray
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Viruses are one of the most prevalent - uh - "things" - on the planet. I hesitate to use the word "lifeforms" to describe something that's basically a bit of genetic material within a protein, but whatever, they outnumber living things so dramatically that there are enough on this planet to assign about a hundred *million* of them to every known star in the universe and still have some left over. There are almost four hundred *trillion* of them within your body (yes, right now) and they outnumber bacteria ten to one. Oh, and both the viruses and bacteria inside you are necessary. Unless you currently have the flu, that's an unwanted one, but the rest are important for your survival.

    Auntriarch
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes! As with bacteria, some are for us, some agin us.

    Load More Replies...
    View more comments

    In this day and age, it’s simply not feasible to make a doctor’s appointment every time you have a small question about your health. So it’s only natural for people to seek out answers on the internet. But what can we do to protect ourselves from the onslaught of false claims floating around? CBC News suggests first using fact-checking tools like Snopes.com to make sure what you’re reading is accurate.

    #16

    Tweet screenshot discussing a false medical claim about an 80 ft blood clot shared online and widely criticized.

    BadMedicalTakes Report

    Mike F
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, I was always under the impression that funeral directors did the enbalming, not the ME staff. Perhaps the ME found an 8 cm clot?

    Debby Keir
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, the body is dead, and the heart no longer pumping, so the blood clots - and there's about 60,000 miles of blood vessels in an adult..... full of clotted material....

    Load More Replies...
    G A
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    He was talking about the OP

    Unicorn
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The average height of the clots I've known is 1.65 m.

    Victor Botha
    Community Member
    6 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    80mm maybe, but 80' I very much doubt.

    #17

    Bad-Medical-Takes-Funny-Fails

    BadMedicalTakes Report

    KatWitch57
    Community Member
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That would be over *your* dead body OP.

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Uhhh, you do you, boo; but I'll take a human please.

    Billo66
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You know the doctor just googles your sh­it in his office right? hehe

    Load More Replies...
    Rick Murray
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I signed into Gemini with a burner account and posed the question. It responded that this simply wasn't going to happen: AI has a non-zero risk of making stuff up, sometimes it can completely misunderstand input, it lacks empathy and understanding so it isn't going to be able to pick up on non-verbal cues, AI often presents made up information with the same authoritative tone as facts making it harder for anybody to spot errors, there are numerous hands-on things that doctors do that a machine cannot, and one cannot hold an opaque algorithm legally accountable - in fact current LLMs are not even capable of demonstrating exactly how they arrive at any particular conclusion. And if you've ever used an AI art app, you'll be well aware that you can get wildly different results from the exact same prompt that are sort-of-maybe what you asked for but quite different nonetheless. The current state of technology can assist doctors, certainly, but won't be replacing them.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Health care in the US could have been solved if it wasnt for corrupt business....

    Sue User
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    With the state of healthcare in USA maybe AI would be better. Brother just went to the doctor. He has severe afib. She wants him to get tested for allergies because of another health issue. Treat the afib first. No triage skills.

    Mike F
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That guy should volunteer to be part of the AI "physician" study group if he feels that strongly about it.

    Debby Keir
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So, it would learn how to treat my 6th finger?

    Maggz Bennett
    Community Member
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This will be the same AI that doesn't always know how many fingers a human has... Pretty sure it'll fail anatomy 101.

    David Morgan
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    "How many 'a's are there in the word 'anatomy'?" "There are three 'a's'..."

    Load More Replies...
    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    We'll no doubt get there eventually, we're still a very long away from that

    David Morgan
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Health care is the US is generally of a high standard (yes, I know there are always exceptions and failings, but generally I'm correct). The reason the system is broken is the appalling unfairness of the access to the healthcare. It doesn't matter if you are poor, or have LOTS of money, the incredibly parasitic insurance companies that intervene between patients and healthcare workers mean that the majority of people are unable to afford good medical care without significantly affecting their lives. That is insane.

    View more comments
    #18

    Screenshot of a social media post spreading incorrect medical knowledge about Tourette’s and neurological diseases.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Why the 60s? Was that when medical knowledge collapsed and people started randomly making up shìt?

    Ace
    Community Member
    Premium
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I guess the 60s was the end, or at least the start of the end, of the 'golden age' when we could just call people r******d, slow, subnormal, weird or whatever other labels we felt like and put them somewhere we didn't have to deal with them on a daily basis. Yes, I remember those days. They were not 'golden' for the poor kids involved.

    Load More Replies...
    laura lee
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You mean the 1860s bc "Tourette syndrome was named by French neurologist Jean-Martin Charcot for his intern, Georges Gilles de la Tourette, who published in 1885 an account of nine patients with a "convulsive tic disorder".

    funkybluegirl (she/her)
    Community Member
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    My son has Tourette's. It has "been around "since the mid 1800's.

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's likely the condition was around long before that, that's just when the first diagnosis was made and named.

    Load More Replies...
    AnnaB
    Community Member
    Premium
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Phycology is the scientific study of algae - which I beieve Jonas has in place of a brain.

    David Morgan
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ah, I'm glad you posted that. I actually thought it was the study of mushrooms. That wouldn't have been as funny, for one thing.

    Load More Replies...
    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Stupid existed before the 1960s, and therefore it is real, and obviously among us. I offer this post as evidence in support of its existence and prevalence

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Fvck off, Jonas. And I DON'T have Tourettes

    joann fielding
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I have enough compassion to hope that the OP never gets a psychological (which he mispelled) disease, and if he does, gets more compassion than he's showing the many suffering from those diseases.

    Apatheist
    Community Member
    4 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Here's a fact: on the 1911 UK census form, the last column (after name, age, occupation etc) is "If sub-normal, state whether half-wit, imbec1le or feeble-minded". I kid you not. What baffles me is - what on earth was the difference? Things have changed.

    David Morgan
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    They were medical terms with defined meanings, not just synonyms. What changed is that the medical profession TRIED to be more cognisant of times when it was callous, and do something to make people more included.

    Load More Replies...
    CooperDooper81
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    There are millions of victims of AIDS who would argue that point if they could.

    Flat_Alien
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Your brain is not a real thing, unfortunately

    View more comments

    It’s also always a good idea to find the original media source if you want to confirm that a claim or statement is true. Don’t believe it just because you heard it on TikTok. Find the exact study or article citing the information, and make sure that it wasn’t used out of context. At the same time, you’ll want to check if various news sources are reporting the same story. If you can’t find it anywhere else, you might want to be skeptical.

    ADVERTISEMENT
    #19

    Screenshot of a social media post spreading medical misinformation about vaccines and health risks, misleading medical knowledge.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    There was a time when child mortality happened at a much higher rate.

    Savannah greenleaf
    Community Member
    Premium
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It is starting to creep back up in the US with so many people spouting off nonsense. It's really quite sad.

    Load More Replies...
    Razill
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yup and this is the same time of infant mortality rates of >50%, and maternal mortality in doube digit as well.

    Armac
    Community Member
    Premium
    6 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    I’m 57, had lots of vaccinations before 1986, I had MMR as an infant

    Rick Murray
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I had it as a toddler. At boarding school (around 1986) they said that was impossible, but to their credit they gave me some sort of test (scratch test?) and, yeah, I did have it as a toddler. So that would have been mid to late '70s.

    Load More Replies...
    #20

    Screenshot of a social media thread spreading disputed medical knowledge and misinformation about disease symptoms and germs.

    BadMedicalTakes Report

    DelvianBlue
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So 1/3 of Europe died of detoxing in the 1300s. Got it

    joann fielding
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Then you won't mind if your surgeon doesn't wear a mask?

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Andrew obviously has experience of abu sing drink

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Snake oil salesman, selling prime snake oil. Lovely snake oil, makes you clever and strong.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What? Everyone with the Black Death was just detoxing?

    David Morgan
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You know, just...healing. Like from toxins. Not any specific, definable toxins though.

    Load More Replies...
    #21

    Tweet expressing skepticism about flu and other vaccines, sharing medical knowledge and opinions that sparked controversy online.

    BadMedicalTakes Report

    Razill
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The life destroying effects of the virus are significantly higher so of ur a gambling person the vaccine is ur choice. Oh right🤦‍♀️my bad. I learned from above thw flu virus isnt real.

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Get that shot and you will halt the body's natural detoxification process! 🤪

    Load More Replies...
    Bartlet for world domination
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If people call every cold the flu, they can't imagine dying from influenza.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The risks, like death?

    Charlotte
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Apparently there is no risk of death from the flu because it's a virus and those aren't real. So all those extra deaths each flu season? Fake! /S

    Load More Replies...
    I am John
    Community Member
    56 minutes ago (edited)

    This comment is hidden. Click here to view.

    Aaaw. It does need to be told more, because its so stupid and wrong. A really great attempt at thinking. What helps, is if you don't start at the conclusion. The stakes are the same from the vaccine and flu. But the odds of a positive outcome are vastly improved with the vaccine. But, its not just about you. The vaccine also reduces the odds of someone else having a negative outcome. Wild huh.

    Meanwhile, when you do find false claims or statements online, don’t hesitate to report them. It can be dangerous for influencers or companies to share outright lies with their followers and customers. Call them out, and make sure that they can’t get away with it again in the future. It’s becoming increasingly difficult to trust anything that we see online, but if we make it unacceptable to spread lies, maybe we’ll start to see less of them. 

    #22

    Tweet questioning medical knowledge with image linking 5G and past pandemics, sparking debate over medical misinformation.

    BadMedicalTakes Report

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I suppose bringing the potato back from the Americas resulted in the Black Death?

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh lort. This was EXACTLY what one of my managers at my grocery store retail job believed. I worked there for two and a half years during the pandemic. This dude was usually the closing manager and I worked the closing shift in my department (vitamins and supplements, and I could tell you plenty of woo-woo stories about my regulars and the supplements they believed would cure things..) So, many a night my manager would follow me around my department while I performed my closing tasks, telling me how "the invention of radio" caused the Spanish flu pandemic in 1918, and he'd list literally all of these same things, right up to "5G was invented and look what happened! COVID!" It took every last molecule of my self-control not to whack him over the head with a giant bottle of liquid bentonite clay.

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don't even have the words....

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Introduction of television caused (????) WHAT.

    Jack Smith
    Community Member
    9 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Radio waves are NOT new. We didn't start getting bombarded with them in 1918. The earth has been bathed in them for it's entire 4 billion year lifetime. There are numerous astrophysical structures that naturally emit EM radiation at every wavelength (including radio waves) including gas clouds, galactic nuclei, neutron stars, quasars, and supernova remnants.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Where was there a cholera epidemic in 1991?

    geezeronthehill
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Causation, correlation, pfft! All same same!

    View more comments
    #23

    Split image showing a man without makeup outdoors and the same man wearing makeup indoors, related to medical knowledge discussion.

    BadMedicalTakes Report

    Savannah greenleaf
    Community Member
    Premium
    10 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Another thing for women to have to worry about. Is my cleavage feminine enough?

    Load More Replies...
    Charlotte
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Eyes set forward in male dominant location? I had no idea my eyes were set backwards, which they must be since I'm not male!

    JenC
    Community Member
    4 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So do women have eyes on the side of their heads, like horses?

    Load More Replies...
    Michael Melfa
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You can find this same kinda weirdo doing this "analysis" on women video game characters trying to root out which ones are the hidden trans.

    I am John
    Community Member
    55 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Name is Kaiser Soze. Fills me with trust.

    Sinead Kenny
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So very sad that this is still so deluded and shielded today

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm guessing OP's calculations only work when they know in advance that the person has transitioned

    Hyacinth (Any pronouns)
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What's even funnier is that the post Kaiser is transvestigating was a reply to 'best transition ever filmed?' No duh they're trans, that's the point of the post.

    View more comments
    #24

    Tweet falsely spreading medical misinformation about SIDS and infant care accountability, sparking rightful online criticism.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This is just out right pathetic.

    joann fielding
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    There's a special place in hell for this OP. Evil, just evil.

    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Nope not hell lucifer has morals , that Ines going to purgatory, with all the other people like him ,

    Load More Replies...
    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Maybe because the mother is the primary caregiver to infants?

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Obviously this person has never heard of Long QT syndrome. Something that is hard to test for, but genetic. My family has it, so this dumb b might wanna do some research before spouting BS. It is likely the explanation for a majority of SIDS related deaths. It also k****d my diagnosed sister at random. Google it.

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This individual can go ahead and EFF themselves. Awful.

    IYAAYAS64
    Community Member
    10 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh FFS 🤦🏽‍♀️ how can anyone be this ignorant?!

    Flat_Alien
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Is this a rage bait or is she projecting. Better call CPS to check on her kids

    Crystalwitch60
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Now this is despicable, cruel incel BULLSHITE 🤬oh and pathetic as Nat said to ,

    Are you enjoying your scroll through this minefield of bizarre and outlandish claims, pandas? Keep upvoting the ones that you can’t believe people posted on the internet, and feel free to share wild medical misinformation that you’ve come across in the comments below. Then, if you’re interested in checking out another Bored Panda article on the same topic, look no further than right here!

    #25

    Screenshot of a social media post spreading medical misinformation, criticized for false health claims and misunderstood biology.

    BadMedicalTakes Report

    Sue User
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    " Their body will never harm itself". Tell that to every person with autoimmune.

    Razill
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, technically an infection is not "the body trying to harm itself" is an invader from an outside source trying to live in ir body. But please keep encouraging this thought because the less people who use "magical pills" (aka antimicrobials) inappropriately, the better the magic will work on those who actually benefit from them.

    I am John
    Community Member
    47 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This is so incredibly dumb. I love it! Its just a mad pile of lies.

    Debby Keir
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Even medics know there is a slight risk, but as below, surgery soon after a positive biopsy minimises any risk. *Extremely Rare: The actual risk of a biopsy causing cancer spread is minimal, often cited as less than 1%. * *Newer Research Insights - Wound Environment: Some studies suggest a core needle biopsy can create a temporary inflammatory wound environment (M2-dominant) that might promote cancer cell changes (EMT, angiogenesis). Delay Matters: A significant delay between biopsy and surgery (e.g., over 50 days) might increase mortality risk in some cancers, as this pro-metastatic state persists. Potential Solutions: Anti-inflammatory d***s (like C*X-2 inhibitors) might help mitigate these biopsy-induced changes if surgery is delayed.*

    #26

    Twitter post by Dan the Musician criticizing scientific views on health, highlighting misinformation and medical knowledge mistakes.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Fine, you will not experience longevity.

    Multa Nocte
    Community Member
    Premium
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Stick to music.

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I think he means critically stupid thinking.

    I am John
    Community Member
    40 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    By critical thinking you mean stoner thoughts?

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm guessing that by critical thinking, he means automatically criticising anyone who thinks

    No one
    Community Member
    43 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Evolution is science

    #27

    Screenshot of a controversial tweet discussing vaccines and autism, related to people spreading medical misinformation.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    He is a real stable genius isn't he?

    Rosecrucian Roeth
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    He belongs in a stable, cleaning out the excrement, if not inhaling it...................ooops, maybe that is why he is what he is.........too much inhaling the BS of his family when he was young:)

    Load More Replies...
    Kristy Marion
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If there was a vaccine for Dementia, Donny would be first in line.

    TotallyNOTAFox
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A brilliant leader with wise decisions we all should trust in... (Joke)

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's a good job Trump isn't in charge of anything.

    Flat_Alien
    Community Member
    2 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Trump, change your d.r.u.g dealer because your hallucinations are really bad

    CooperDooper81
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Trump is clearly on the spectrum himself.

    #28

    Tweet spreading incorrect medical knowledge about tissue and blood type matching across races, reflecting medical misinformation shaming.

    BadMedicalTakes Report

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I've been told my O- blood is useable by most people. Must just be a lie put out by the people who make the cookies we get when we donate blood, to sell more cookies (am I getting the hang of this conspiracy stuff?)

    Akaya Matsumoto
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sounds legit :-) Can't trust those evil cookie companies! Beware Big Cookie!

    Load More Replies...
    Armac
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Absolute twaddle

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Dear God. He actually thinks that if a pathologist was handed some heart tissue they could tell you what ‘race’ the person belonged to?

    #29

    Tweet claiming cancer is caused by parasites, heavy metals, and stress, falsely linking COVID-19 vaccines to disease spread and misinformation.

    BadMedicalTakes Report

    Daisydaisy
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Who are these people and why are they allowed to publish their batshit-crazy notions?

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Parasites is a new one on me. I knew to expect webbed feet and metal things sticking to me but this? Last straw! /S

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I am impressed how somebody managed to write something where everything is completely wrong

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, at least they spelled the words correctly.

    Load More Replies...
    Rick Murray
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Vaccines contain parasite eggs? Is this the next line of bollocks after the 5G trackers thing was firmly ridiculed for being technologically impossible?

    Armac
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Good lord, none of those things can in any way cause cancer..

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh, parasites is still doing the rounds, is it? I didn’t know there were parasite eggs in vaccines! LOL.

    #30

    A viral tweet spreading medical misinformation about the flu, vaccines, and toxins, sparking online criticism.

    BadMedicalTakes Report

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I bet he always eats his chicken raw.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Uh, guys, I like to sometimes be silly on here and pretend I'm an actual wolf, but I'm not. I'm human. We aren't meant to eat raw meat the way a true animal carnivore is. "It isn't natural to cook food" is an unhinged statement.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    No, the flu is a category of virus. The category of virus was named - The Flu. That's why its the flu. Amongst other things your body has a detox response to... The Flu.

    Bi.Felicia
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Acidic mucus?? Apparently if you don't cook any your food, you won't have any mucus in your body, including the acidic type.

    #31

    A Twitter post spreading false medical knowledge claiming cancer results from emotional and spiritual trauma.

    BadMedicalTakes Report

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh Mylanta. The ignorance is making me verklempt..

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Seriously. This one is #25 on the list currently and I'm not sure I can read through the rest of the entries without screaming in agonized rage XD

    Load More Replies...
    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Here's hoping Alex manages to stay out of anything health related as a profession. Sewage management might suit as she clearly has experience with sh1t

    Rosecrucian Roeth
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'm a cancer and I'm a result of my date of birth!

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'ln which case, I'm inclined to posit that OP is Taurus...

    Load More Replies...
    Alex Kennedy
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I mean, let’s imagine for a second it is… so what? The most effective way to treat it is holistically including chemo- or radio-therapy.

    FranSinclair
    Community Member
    10 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    So, like, reincarnation? or was it just a traumatic birth experience for our newborns and children that have had to suffer this horrible disease in AlexLand?

    I am John
    Community Member
    51 minutes ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    No its not. Prove it. I want to see a p-value. Go get some tumours and do the genomics. Go and get bone marrow from some babies with Leukemia. Maybe tell their parents whilst you are at it, they will be thrilled to learn about their babies emotional and spiritual trauma at this difficult time.

    View more comments
    #32

    Tweet claiming drinking water is unhealthy with false medical knowledge shared and criticized online on social media platform.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Dihydrogen oxide needs to have RFKJr. and his Wizard of Oz prohibit its usage.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Personally I only drink dehydrated water.

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I hope Snackbottle does his own "research" and goes without "water", or Dr Pepper for a couple of weeks.

    Miki
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    100% of people who drank water died. Checkmate.

    I am John
    Community Member
    35 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It fun having an imagination.

    Sarah Belt
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Fancy way of admitting they drink their own urine...

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Dear Lord, I will never, ever be able to estimate how ridiculous a claim someone can make in the guise of health advice.

    #33

    Screenshot of a social media post spreading misinformation about vaccines, autism, and medical knowledge.

    BadMedicalTakes Report

    Rosecrucian Roeth
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    For a split second there, I thought you wrote Hogwarts.....................

    Load More Replies...
    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    But they all behave as if they do, rejecting modern inventions and beliefs.

    Rick Murray
    Community Member
    3 hours ago

    This comment is hidden. Click here to view.

    Copy-pasted from a quick search: There is a common misconception that low autism rates in Amish communities are linked to their vaccination practices. However, many Amish children do receive vaccinations. Studies have shown that the prevalence of autism among Amish children is not absent but may be underdiagnosed due to the factors mentioned above. [they are Cultural Beliefs, Healthcare Access, and Educational Environment]

    Flat_Alien
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Low quality rage bait

    #34

    Social media post spreading questionable medical knowledge about vaccines and mercury, illustrating medical misinformation and shaming.

    BadMedicalTakes Report

    Tyranamar Seuss
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    W*F? Do people just pull stuff out of their a*s?

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    But, isn't that only true if mercury is in retrograde?

    Armac
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This made my head hurt, and my teeth itch.

    Rick Murray
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    🤷 True story about mercury. When I started boarding school, in 1985, we dipped our fingers into a beaker of mercury and pinged blobs of it around the table. My last year there, in 1990, the teacher dropped one of the last mercury thermometers and we all had to leave immediately, plus evacuate neighbouring classrooms, and have an expensive decontamination crew come and clean it up. My offer to "my god,, I can just slurp it up with a pipette" was firmly denied. It's 36 years later and this person is just stark raving bonkers.

    Rosecrucian Roeth
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Another dumb "cult" follower............

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I confess to reading "cult" incorrectly, but it still worked.

    Load More Replies...
    kissmychakram
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's a theory, yes. It is also utter bullcràp.

    Roxy222uk
    Community Member
    1 hour ago

    This comment is hidden. Click here to view.

    I thought it was polysorbate that reduces the effectiveness of the brain barrier (isn’t it used to help medication specifically for the brain reach it?) and the presence of it in vaccines was being argued it help heavy metals into the brain? I’ve never heard of vitamin K doing that. I thought vitamin K helped with blood clotting, but it’s not going to do that while the blood is still circulating. And what the hecky peck is Tween 80?

    View more comments
    #35

    Screenshot of a social media post spreading medical misinformation about the flu and body detoxing during holidays.

    BadMedicalTakes Report

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Maybe, just maybe, being in close proximity to large numbers of people in a confined space has something to do with it.

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Specifically large numbers of people from other places. All those lovely pathogens mixing together.

    Load More Replies...
    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I thrive on sugar and carbs and have never had influenza in my life! I want to know what all this "detoxing" garbage is about. My body naturally detoxes every day. That's what kidneys and livers are for, it's partly why we have all those organs just under our skin.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    No. I notice its bad the first few weeks after returning to school from a holiday. You have taken two made up concepts and joined them together into a fantasy.

    #36

    Tweet screenshot discussing misconceptions about measles and children’s development, related to medical knowledge spread and shaming.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Strong focussed children? Also blind children. And dead ones.

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    RFKJr.'s Brainworm speaking again.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Most children? I'd like to see what made up graph Mona coloured in with crayons to back this up...

    #37

    Tweet from The Yorkshire Lass claiming flu doesn't exist and describing it as a body purge and toxin removal, spreading medical misinformation.

    BadMedicalTakes Report

    I am John
    Community Member
    1 hour ago

    This comment is hidden. Click here to view.

    Yes, there is such thing as the flu. Particularly in Yorkshire where its a bit grim. Here are the first 100 amino acids of the influenza virus: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI. Please prove to me it this doesn't exist in nature. Then demonstrate that its not significantly elevated in people complaining of the flu. We can take it from there.

    panther
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Having a massive purge is what I do every morning on the toilet.

    kikinlivi
    Community Member
    55 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yorkshire Lass does it on social media

    Load More Replies...
    #38

    Tweet screenshot of a user spreading medical knowledge about menopause and menstruation, resulting in public shaming.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I wonder how old she is at the time of posting? I wonder what would happen if we revisited this woman a few years from now.

    Am I Funny? Maybe or maybe not
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Her stupidity and false confidence would have gotten her k****d.

    Load More Replies...
    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    People like this being taken seriously is one of the few valid arguments against free speech.

    Fish Face
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I’d like to invite this person to my mom’s group so some very temperamental perimenopausal women in good health can debate this with her. She’ll walk out crying.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Not seeing many women in their 80s giving birth....

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I could maybe understand a guy coming out with this nonsense, but a woman knowing so little about how a woman's body works is actually rather disturbing.

    Dog Lover
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I always wondered why my healthy 90 year grandma wanted tampons! *sarcasm*

    I am John
    Community Member
    29 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Roll up, roll up, lovely snake oil for sale! I've been around the world and noticed old women don't menstruate, but they are also not as healthy as young people. Coincidence - I think not! Subscribe to my channel and learn the secrets of healthy diet and lifestyle. You too can menstruate like a champ, right into your 90s.

    Roxy222uk
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Better tell that to female orcas and female elephants then, with their suboptimal diets and suboptimal lifestyles

    View more comments
    #39

    Screenshot of a Twitter exchange where a user spreads medical misinformation and is corrected online.

    BadMedicalTakes Report

    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Remember the good old days when people were embarrassed about their ignorance? Now they wave it like a banner.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Defiant Baptist sounds defiantly ignorant.

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    are they talking about orga$m$?

    Roxy222uk
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Do you think he thinks he’s called Definite Baptist?

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hmm. My mom had me, her first, at 35, my sis at 37, my brother at 42.

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I think they've got their biblical stories mixed up with Noah's Ark

    Flat_Alien
    Community Member
    2 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    And you will have 0 kids as your stupidity is perfect women repellent

    Rosecrucian Roeth
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What are they talking about? Thoughts? Breaths? S*x?

    #40

    Tweet claiming chemo kills often and damages health for decades, showing misinformation in medical knowledge discussions online.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Don't do chemo, you won't have any health at all for decades after in the cemetery.

    The Short Lady
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    D3ath from cancer wrecks your health permanently.

    Lotekguy
    Community Member
    Premium
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Chemo has a lower k**l rate than cancer.... for those keeping score at home.

    Annik Perrot
    Community Member
    5 hours ago

    This comment is hidden. Click here to view.

    Chemo's no bed of roses (boy, do I know), but it's highly preferable to the alternative. After eight rounds of it, and à 7 hours surgery, seems like I will live. The first four rounds, pre-surgery, had reduced the tumor by 75%, and it seems the surgery removed everything. The next four rounds were "preventive". At the very worst, if it ever should come back, it has bought me à few years to see my grandkids grow. It's sheer misery, they pump you full of poison that takes weeks to drain out, but it's definitely worth it. Don't believe the fake news, people, and obediently do everything your oncologist tells you. They know their stuff.

    Multa Nocte
    Community Member
    Premium
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Annik (since I can't answer below) - Hugs and best wishes! XXXXOOOO

    laura lee
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Kills the cancer cells, yes

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And healthy cells too, but you have more of those.

    Load More Replies...
    #41

    Tweet from user sharing an outdated medical remedy involving a white onion tied to a bed post, showing medical knowledge misconceptions.

    BadMedicalTakes Report

    Razill
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yup. Amazing coincidence that most respiratory viruses symptoms resolve in 7-10 days.

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You obviously don't understand. She had an onion by her face, and got better! /s

    Load More Replies...
    Ace
    Community Member
    Premium
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The same sort of person will take medications for a couple of days and then announce that they didn't need them as they got better anyway.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago (edited)

    This comment is hidden. Click here to view.

    I had the flu once. It lasted about a week. I was "cured" without an onion in a sock. Maybe the onion in a sock is not needed? By the way, during that week I felt like I was dying, and I would not of minded it, I was that bad. Never again please.

    Miki
    Community Member
    Premium
    7 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    In PL we say (maybe not only here?):"A treated cold lasts a week, an untreated cold lasts 7 days"

    Kim Karlotta
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    In Germany as well. To be fair, onions do have components that can help with the symptoms of the flu or a cold and it has been a longtime remedy to place cut up onions either on your neck or your feet. Still OP is obviously wrong to imply that you don't need anything else, ever, to cure a flu.

    Load More Replies...
    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The same would have happened if she had done absolutely nothing

    I am John
    Community Member
    25 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And what was the onion for?

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    As Mr Auntriarch's mother used to say, if you go to the doctor's with a cold it'll only last a week, if you don't it'll go on for seven days.

    Debby Keir
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Look, if you just leave things, you'll suffer for 7 whole days, but if you take my medicine, it's all over in a week....

    View more comments
    See Also on Bored Panda
    #42

    Tweet claiming H5N5 bird flu found in human, followed by misinformation about viruses and transmission, reflecting medical knowledge spread.

    BadMedicalTakes Report

    Am I Funny? Maybe or maybe not
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    How did this guy manage to deny everything a virus is.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    An impressive amount of wrong.

    TotallyNOTAFox
    Community Member
    13 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    People that are easily yucked out shouldn't read further - Everytime we are outside we breath in all kinds of bird feces as aerosol mist, so f*****g yes it can be transmitted by air. Infecting birds with pathogens is one of the best methodes to delivery a virological bioweapon over a large area in theory (The more you know)

    Roxy222uk
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sometimes I kinda get what people are getting at, but this one I don't

    #43

    Screenshot of a social media post spreading controversial medical knowledge that received public shaming for misinformation.

    BadMedicalTakes Report

    TotallyNOTAFox
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I bet on 500 GB of certain content on that person's PC, law enforcement should take a look to be sure

    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Betting Doug Carter hangs around the school gates at home time, wearing a long coat

    Sue User
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The youngest person to have a baby was five.

    laura lee
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    S****l maturity does not equal intellectual maturity

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yep. I started menstruating when I was 11. I can assure all and sundry that I was still ABSOLUTELY a child, despite my menses.

    Load More Replies...
    I am John
    Community Member
    36 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Doug Carter tweets from prison...

    #44

    Screenshot of an article headline about facial analysis and hiring decisions in a digital news format.

    BadMedicalTakes Report

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The blemish on my left cheek is indicative of extraordinary intelligence. Trouble is, it's my bùtt cheek. So I always moon the facial ID cameras. By the way, TSA agents sure can be grumpy.

    I am John
    Community Member
    23 minutes ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes - an exciting new paper from the international society for Phrenology. In it they take photos of peoples faces whilst they hold up their own C.V. Then put the photo through and AI.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Someone’s developed a new app they want to hawk

    Rick Murray
    Community Member
    3 hours ago

    This comment is hidden. Click here to view.

    If a company sent me a request like that, they're likely to get back a photo like 🤪 with 🖕. Which is, let's face it, more than I'd do for a company that wanted to pre-screen my application using a chatbot. FTS.

    Miki
    Community Member
    Premium
    7 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    If the facial analysis checks someone's police files than sure it helps :p

    #45

    Tweet claiming SNAP recipients have high obesity rates, spreading medical misinformation and facing public criticism online.

    BadMedicalTakes Report

    emorinelli49
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    They live in food deserts and often have no access to fresh foods. They are stuck buying 13 frozen burritos for $10 so they can eat at the end if the month when their food stamps run out.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    88.2% of all statistics are made up. Vic Reeves.

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The fact that poor, unhealthy food is much cheaper than fresh and healthy food has nothing to do with it

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Such a complete misunderstanding of how nutrition and poverty work in the modern world.

    #46

    Screenshot of a tweet sharing inaccurate medical knowledge about LED exposure and health risks, sparking online criticism.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Health Effects of 480 nm Light: Melatonin Suppression: It can suppress melatonin, helping to regulate wakefulness. Mood Enhancement: Stimulates serotonin production, improving mood and reducing symptoms of seasonal affective disorder (SAD). Cognitive Function: Enhances focus and reaction time. Skin Health: Used in dermatology against acne and bacteria.

    #47

    Social media post spreading questionable medical knowledge about CO2 inhalation and health benefits, widely criticized online.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hypercapnia: Inhaling air with high concentrations of CO2 can lead to hypercapnia, a condition characterized by excessive carbon dioxide in the blood. Symptoms include dizziness, headaches, shortness of breath, and in severe cases, confusion and loss of consciousness. Physiological Effects: When CO2 levels increase, it combines with water in the blood to form carbonic acid, lowering blood pH and leading to respiratory acidosis. This condition can disrupt normal bodily functions and impair oxygen delivery to tissues, resulting in tissue hypoxia. Health Implications: Breathing air with CO2 concentrations above 5% can cause noticeable symptoms within minutes, while higher concentrations can lead to severe health risks, including respiratory failure and coma.

    Greymom
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    ALS I was born and raised in the mountains. Wonderful people there , but trust me, none of us were any leaner, more attractive or energetic than the rest of the population!

    Ace
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Quite apart from the nonsense about CO2 being so good for you, why does this person think that there's more of it in the mountains? In fact there's a tiny decrease with altitude, from about .0395% at sea level to .0385% at 2000m, above which it stays the same.

    I am John
    Community Member
    22 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Veronica's stoner thoughts.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Um, well we need a certain amount in the air because it is the trigger to breath out and breath in again, but I would *love* to see the chemical formula that show how it is used in the mitochondria, for example.

    #48

    Twitter conversation discussing free healthcare with medical knowledge claims being debated and challenged online.

    BadMedicalTakes Report

    TotallyNOTAFox
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Healthcare isn't free, but universal healthcare is a lot cheaper for the people than whatever the US has going on

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I love the mentality of these people when they use the term "free healthcare". I paid my taxes for years (still do) and I had "free healthcare". In the US, people seem to have to pay for an ambulance trip, treatment (at hugely inflated prices), and the bill is far and away much higher than the investment I made in paying tax at a higher rate than the US citizens talking about "free healthcare". I am now on a variety of medications for which I pay absolutely nothing. I hate to think how much I would be paying in the corrupt system in the US.

    I am John
    Community Member
    20 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yeah, and when you mention to these people they already get free roads, schools, police, elections, etc, it somehow not the same...

    Load More Replies...
    #49

    Screenshot of a medical misinformation video featuring Dr. Sherri Tenpenny discussing a controversial vaccine claim.

    BadMedicalTakes Report

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago

    This comment is hidden. Click here to view.

    Homeopathy is a woo-woo pseudoscience. The principles of it are "like cures like", so by a homeopathic doc/vet's viewpoint, if you've been bitten by a snake, you need to take a substance that literally causes SIMILAR SYMPTOMS TO A SNAKEBITE. But that's not all! They actually believe that the LOWER the dose is, the STRONGER the "medicine" is! So they'll brew up a big batch of belladonna in water (I'm not even kidding, they think it'll cure fevers, headaches, and inflammatory conditions because that's what belladonna poisoning CAUSES) but then they'll dilute it down until there's literally no molecules of the belladonna left in the water. They actually BELIEVE that the water "REMEMBERS" the belladonna and still retains its "curative" properties. It's entirely unhinged. Please do not treat illnesses with homeopathy. See a real doctor/vet.

    Lady Eowyn
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Poor dog...homeopathic vet?

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I promised to give a dog I adopted "homeopathic food". Still don't know what that means! ( He lived to be 15 so I figure I couldn't have fed him too badly)

    Load More Replies...
    Rick Murray
    Community Member
    3 hours ago

    This comment is hidden. Click here to view.

    Can't reply to LakotaWolf, so I'll drop it here. I ran into this in the '90s in the UK when some weirdo was trying to get my mother interested in Bach flower remedies. Like, the more dilute the stuff is, the more potent. Since we were both science nerds, that set off alarm bells so we, uh, decided upon a different path. But, yeah, it was a bit mental what the advocates of the little Back bottles actually believed - including the stuff about "remembering" (if I recall, the remedies were diluted in brandy or something, not water, as the alcohol was a natural preservative). Either way, as you say, unhinged.

    #50

    Screenshot of a Twitter post spreading false medical knowledge about measles and vaccines, illustrating medical misinformation.

    BadMedicalTakes Report

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Anyone that believes the above, written by a moron in his mum's basement, in his sweaty underpants, needs to update!

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That vaccines cause autism bull💩 never gets old

    Anyone-for-tea?
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I didn’t know I had cancer because I was weak. Good to know the actual cause, anyway I’m off to find some turmeric and healing crystals.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh, are we just going to completely overlook the fact that measles can cause corneal ulceration, which can lead to corneal scarring and blindness? We just going to ignore the fact that measles can cause a version of encephalitis that is progressive and always fatal? Okay.

    V
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And that it can actually wipe away immune memory, meaning that you lose immunity to other viruses that you were previously immune to. SMH

    Load More Replies...
    I am John
    Community Member
    17 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Just another random assortment of incel thoughts cobbled together into a sort of threat.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    My blood pressure is rising dangerously. This arsëhole has almost certainly been vaccinated against measles, and has the fücking nerve to talk about culling the weak.

    Unicorn
    Community Member
    2 hours ago

    This comment has been deleted.

    #51

    Tweet claiming sunscreen causes cancer instead of the sun, spreading false medical knowledge and misinformation online.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The sun was invented by the sunscreen manufacturers so they could sell their products.

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Since the sun revolves around the flat earth, we should be able to put it in one place and live elsewhere.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    My father has had three lumps cut off his head and ears. He's never used sunscreen in his life. He has spent the first half of his life in the sun though.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Honestly, I hesitate over the sun causing skin cancer. How the héll did we evolve as a species if the sun is dangerous to us? I think it’s more likely that people’s diets are too UPF and too low in all the natural antioxidants to protect us. We need artificial sunscreens because we can no longer protect our skin ourselves.

    See Also on Bored Panda
    #52

    Screenshot of social media post spreading false medical knowledge about mRNA shots and population control conspiracy theories.

    BadMedicalTakes Report

    TotallyNOTAFox
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And yet my sister had 2 children after getting 3 Covid shots... a miracle!

    I am John
    Community Member
    15 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Angry nonsense. It sure is fun having an imagination.

    #53

    Tweet claiming measles is not deadly and can be treated at home with homeopathy, spreading false medical knowledge.

    BadMedicalTakes Report

    TotallyNOTAFox
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I see that people return to the concept of natural selection by making sure their stupidity doesn't contaminate the gene pool any further

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh lawd. I worked at Sprouts for two and a half years in the vitamins and supplements department. I hated having to sell homeopathic products and "remedies". My department manager loathed me because I'd point out where the homeopathic products were if people asked for them, but I wouldn't try to "sell" them. We also sold these big giant jars of liquid bentonite clay that people would buy.. to drink. They thought the clay would "cleanse" their bodies. People would also come in thinking that tart cherry juice pills would cure their gout, black walnut hull pills would "cleanse" the "parasites" they totally had in their digestive system, and milk thistle extract would "detox" their liver. I felt like a snake oil merchant and complete charlatan the entire time I worked there.

    I am John
    Community Member
    13 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Correct. Not "deadly, just deadly. You can of course 'treat' it at home with homeopathy, but, it won't do anything.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I'll be generous and assume that someone doesn't know their rubella from their rubeola either

    #54

    Tweet screenshot showing a medical misinformation post spreading false healing claims, sparking criticism online.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Support your local witches, be healthy.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ah that'll Crystalwitch for me then. But she uses modern medicine as well! (head explodes)

    Load More Replies...
    #55

    Screenshot of a tweet sharing controversial medical knowledge claims about muscles, illustrating medical misinformation and public shaming.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And underneath the skin of some "people" is their true outer covering, that of lizard skin. Lizard people rule the earth.

    #56

    Tweet claiming prostate cancer never causes death, spreading medical misinformation and leading to rightful shaming online.

    BadMedicalTakes Report

    Tyranamar Seuss
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's not true that no one dies of prostate CA. However It is true that a very large number of men, if they live to be old enough, would be found to have prostate CA upon anutopsy. And be largely unsymptomatic except for problems peeing. All men eventually get prostate issues if they live long enough.

    Greymom
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    However even prostate cancer ( just like breast cancer) isn’t all exactly the same same and doesn’t behave the same way in all men. It CAN and DOES certainly metastasize in some cases and will k**l you in many of these cases, particularly if a man develops it at a younger age. This is why regular simple testing is so important so the patient AND their educated urologist can look a the patient’s overall picture of age, general health, and comorbidities and decide what the best course of treatment is. Sometimes, that’s watching and waiting and essentially doing nothing. Other times it’s significant treatments and or surgery.

    Load More Replies...
    Cee Cee
    Community Member
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hmmm. I wish that were true then my friend Bert would still be roaring around on his R1.

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ok, keep your prostate cancer untreated then. Everybody has the right to die of their own stupidity

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Um, my dead uncle Clem would dispute this. He didn’t seek help until far too late.

    Mel in Georgia
    Community Member
    Premium
    10 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    My dad's undetected prostate cancer metastasized into bone cancer, which ultimately k1lled him.

    Ian Webling
    Community Member
    22 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A doctor told me, "Few men die from prostrate cancer but many men die with it.' "

    #57

    Politician speaking at press conference about childhood vaccine mandates with people listening in the background.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Look up the meaning of "Florida Man."

    #58

    Tweet from Susan Lee claiming newborns need no vitamin K shot, reflecting medical misinformation shared online and public shaming.

    BadMedicalTakes Report

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I did loads of research (back in the days of books, not youtubers) and declined the vitamin K, but requested that if my midwife felt the delivery had been in any way traumatic etc that she suggest the shot and we’d discuss it. I’m not anti anything, but wary of automatic delivery of one size fits all care. Neither time did the midwives mind this at all.

    #59

    Screenshot of a Twitter post spreading medical misinformation about man-made molecules and human health effects.

    BadMedicalTakes Report

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This'll be someone who chugs diet pop like there's no tomorrow

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    [looks awkwardly at microplastics and PFAS]

    #60

    Tweet by Grant Cardone spreading misinformation about mental illness and medical knowledge, criticized for false claims.

    BadMedicalTakes Report

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Who vote for bad politicians en masse.

    Camilla Olsen
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don`t think I can face palm my self any more today without getting a brain damage. How on earth can people belive this and other things on this list.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Fück me, he needs a big slap for such an ignorant comment. Mental illness is not a choice, it is often a sane reaction to very, very difficult thoughts and situations.

    Dog Lover
    Community Member
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Since when is dyslexia a mental illness?

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Something is wrong, it involves the brain, two plus two equals eightyteen or something.

    Load More Replies...
    #61

    Podcast screenshot showing Joe Rogan sharing controversial medical opinions on measles immunity and public perception.

    BadMedicalTakes Report

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's true that you don't meet a lot of people who died of measles

    Greymom
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    2024. World Wide measles deaths totaled roughly 95 thousand people according to the World Health Organization. ( An organization the US just pulled out of because our stupid excuse for a government doesn’t like.all that pesky data and facts they produce)🙄. Not sure how to provide the link to the WHO data but it’s easily searchable.

    Black Cat
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I think he's getting measles and chicken pox mixed up.

    Inigo Montoya
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yep. He was born after the measles vaccine was widely administered in the US. I'm sure he got MMR vaccine as a small kid.

    Load More Replies...
    Debby Keir
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, that's called herd immunity - but stick a measles outbreak in a group that haven't been vaccinated and where there's not been measles for some years, and BINGO. US in 2025 *About 69% of the confirmed cases were among children and teens. Across all ages, 11% of patients were hospitalized and three people died, including two children.*

    Bi.Felicia
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Joe sounds like he's mixing up measles with chicken pox

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I mean, he’s not wrong. Most people do just have this childhood illness and recover. Look at how it’s treated in sit-coms from the era, it’s treated as funny with someone all covered in spots, not as a seriously life threatening condition. The fact is that it is a small number of children that will affected at all in the long term. If this fact was openly discussed and parents told ‘we just don’t know which of these groups your child will fall into’ it would make far more sense than just telling them if their child catches measles they will die.

    See Also on Bored Panda
    #63

    Tweet spreading false medical knowledge claiming sickness is not contagious and blaming others for cold or flu as a conspiracy theory.

    BadMedicalTakes Report

    Multa Nocte
    Community Member
    Premium
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Why don't all these people get together and find a place to live away from the rest of us? We could call it something like Ignoramistan.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It would only ‘literally’ be a conspiracy theory if you are claiming they infected you on purpose. They don’t even know what ‘conspire’ means.

    #64

    Tweet screenshot showing a user sharing controversial medical opinions, illustrating people spreading medical "knowledge" and facing criticism.

    BadMedicalTakes Report

    I am John
    Community Member
    1 hour ago

    This comment is hidden. Click here to view.

    Well, science does trust nature. But nature doesn't care how long we live as individuals. Some nature attacks other nature, by eating or stealing from. That's what a parasite or virus does. Steals our bodies resources until we die. Our immune system, also nature, tries to stop it. If you were in a cage with a tiger you'd be happy to have a gun. An artificial thing that helps our natural defenses against natural harm is ultimately good for us. Its fascinating how folks who "don't trust the science" know nothing about it. They are scared of the dark.

    Roxy222uk
    Community Member
    1 hour ago

    This comment is hidden. Click here to view.

    Again, this isn’t 100% wrong. Health is from good food, good air, good water, good housing, good movement, good mental health etc. None of this is made from medical treatments. But I’m very fond of medical treatments being available when something goes wrong.

    #65

    Tweet discussing misinformation from holistic healers about cancer and alkaline conditions, highlighting medical knowledge mistakes.

    BadMedicalTakes Report

    DelvianBlue
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Technically this is true. If your blood pH is above 7 you are most likely deceased, and so no more cancer!

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    You still have cancer, it just does not bother you anymore 🤣

    Load More Replies...
    TotallyNOTAFox
    Community Member
    12 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Funny thing, the blood pH value lies between 7.35 and 7.45, anything lower or higher is actually lethal. My argument in a discussion as somebody who has knowledge about biochemistry

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago

    This comment is hidden. Click here to view.

    I worked with a guy who "only" drank alkaline water and said his "body was totally alkaline with a pH of 8". According to him, he hadn't been sick at all since the 1990s, because bacteria and viruses can't survive in an alkaline body. I pointed out to him that if he drank enough alkaline water to actually change the pH of his blood/body to a pH of 8, he'd be dead. He was also really big into homeopathy. We didn't get along, because I live in actual reality where we have science and medicine XD

    Load More Replies...
    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It's true! There are no cases of baking soda ever having had cancer!

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes, holistic healers say that. Doesn't make it remotely true. Good luck at the morgue. Having spent all your savings before you died on shovelfuls of herbs and essential oils, your kids will now inherit nothing of use.

    Unicorn
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If we mix the baking soda with bleach we can cure Covid at the same time.

    #66

    Tweet about taking a child to an infant chiropractor after birth trauma, illustrating medical knowledge shared and criticized online.

    BadMedicalTakes Report

    Apatheist
    Community Member
    4 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don't trust chiropractors. They're so manipulative.

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Infant chiropractor? That's a thing?

    #67

    Tweet screenshot with a controversial medical opinion on gender, sparking widespread criticism for spreading incorrect medical knowledge.

    BadMedicalTakes Report

    hkbnz9trgw
    Community Member
    11 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Raise your hand if you have no clue about hysterectomies

    Miracle Max
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    When someone has a hysterectomy, what do they take out? So they had a womb before, so he's still correct.

    Load More Replies...
    G A
    Community Member
    12 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Elon, just fvck and di e. The world would be vastly improved by one less rich arsehole.

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    16 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If you could literally save the world's population from starving and you do not, what does that make you?

    Grace Sssssss
    Community Member
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Hmm, lost my uterus to cancer, so I guess I'm not a woman any more...but I'm not a man, so...I must be some third gender? Like, a nonbinary? I love how these right-wingers make the definitions of gender so strict they wind up creating all these "others", the very thing they're railing against.

    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    👋 guess I'm an it as well, same thing cancer

    Load More Replies...
    Greymom
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Not to mention women who are actually born without a uterus. Rare but it does happen.

    Anyone-for-tea?
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Or born with two (my sister was). Makes someone doubley good I guess!

    Load More Replies...
    laura lee
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    So where are the clapbacks I was promised in the header?

    View more comments
    #68

    Tweet from Andrew Kaufman MD spreading medical knowledge about appendix healing and alternative treatments, drawing criticism online.

    BadMedicalTakes Report

    Tyranamar Seuss
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    This person is claiming to be an MD? They need to be reported to the board.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago

    This comment is hidden. Click here to view.

    He's apparently a psychiatrist. He famously claimed that COVID-19 wasn't real because viruses don't exist. He also denies the existence of the viruses that cause things like the common cold, polio, HIV/AIDS, viral hepatitis, chickenpox, and measles.

    Load More Replies...
    Armac
    Community Member
    Premium
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    If he’s an MD, then I’m a nurse practitioner with a PhD…. Oh wait. 🤷🏻‍♂️

    Geobugi🇰🇷🇰🇭
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    MD??? Where did he get his degree? Heard and Macdonaldislands medschool? I assume he is american, is there no such thing like a minimum requirement to be able to study medicine in the US? Serious question, with some people here, i really wonder how they made it

    Multa Nocte
    Community Member
    Premium
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    It gets worse: "In the video Dr Kaufman advocates for consuming a teaspoon of turpentine mixed into a quarter cup of castor oil, and repeating this daily. He says this should be done in “systemic illness, even like sepsis”."

    Load More Replies...
    Unicorn
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A burst appendix is not a "path to optimal wellness" either.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Snake oil salesman selling prime snake oil.

    Roxy222uk
    Community Member
    43 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Again, not 100% incorrect. Some ‘ectomies’ that were very in vogue for a while (e.g. removing a child’s tonsils almost as a matter of course) have been found to be unnecessary in a lot of cases, and even more recently the myth that tonsils didn’t do anything anyway was disproved. The same will happen with other ectomies, and they will be used more judiciously in the future, with treatments developed to try and help people retain them if possible. Also, does anyone remember when loads of children were having their adenoids removed? Is that still a thing? What even are the adenoids? This doesn’t mean someone should try and treat a ruptured appendix with water fasting, but I don’t think that’s what he means anyway. Although these stupid little Tweets without context are just asking for trouble.

    #69

    Screenshot of a mistaken medical claim on Twitter about rabies and wound treatment, illustrating misinformation spread.

    BadMedicalTakes Report

    Greymom
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And then you would get to experience a horrific and painful death! Natural population control. Win win.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Yes, "rabid animals are usually starving and in a highly stressed state". Maybe, because they are dying of rabies.

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Being from an area with high rates of raccoon rabies - actually it's been proven over and over and over...

    Unicorn
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I assume "CLO2" means chlorine dioxide. It boils at 10°C to give a yellow gas and is explosive in contact with organic matter.

    Roxy222uk
    Community Member
    58 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What’s CLO2? We don’t have rabies in the UK. Is the logic that none of our wildlife is ever starving?

    #70

    Tweet discussing parenting questions focused on child health, highlighting medical knowledge shared and critiqued online.

    BadMedicalTakes Report

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sure, lie to the doctor. That really helps the diagnosis.

    Unicorn
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Babies ride bicycles from the age of two months, though they don't always eat their vegetables.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Babies are about parenting, they don't get to make decisions for themselves until later (toddlerhood being the stage where you are desperately trying to protect them from the decisions they would like to make)

    Bi.Felicia
    Community Member
    Premium
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Just always answer yes... Yup, mmmhm, of course, always. They never answered with a yes, also if she's still sleeping in a crib, not sure she should attempt riding a bike, even with a helmet on.

    #71

    Tweet claiming Western dental practices are a scam and cavities can be prevented without drilling, spreading false medical knowledge.

    BadMedicalTakes Report

    Woof Yo
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Of course he hasn't had cavities in the last 8 years - if you don't go to a dentist, a dentist can't tell you that you have cavities. that's using the old noodle

    Stephanie Did It
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Let's see his take on it when he develops an actual toothache.

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What?! My 7 wisdom teeth were the result of a "mineral deficiency" according to this imbecilic twátwaffle?

    See Also on Bored Panda
    #72

    Screenshot of a social media post spreading misleading medical knowledge about raw milk and health challenges.

    BadMedicalTakes Report

    Roxy222uk
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ha ha ha. Raw milk is legal in the UK, so the idea that it will automatically k**l anyone that imbibes it is nonsense. In fact dairies licensed to sell raw milk are held to *much* higher standards than those only selling pasteurised milk. And raw milk does contain more living factors than pasteurised milk, obviously, because the mother passes on immune cells to the calf, plus there is good bacteria in there. I’m not ‘advocating’ for raw milk, I really, really don’t care what people drink, but it annoys me when Americans throw raw milk into the discussion as being as stupid as saying gummies will cure cancer.

    Debby Keir
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Brucella abortus will sort your children out.....

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Views a plot of life expectancy vs time. Lols.

    WD Jackson
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    OK, each generation of your children gets weaker and has more health challenges from raw milk and raw mulk products.

    #73

    Screenshot of a social media post spreading medical misinformation about tetanus vaccines and health risks.

    BadMedicalTakes Report

    The Short Lady
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    They need to see someone expire from tetanus. It's very much not a pleasant way to go.

    laura lee
    Community Member
    13 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Used to be called lockjaw get your d**n shot and stop whining

    Daisydaisy
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, I can't read any more of these. I've run out of faith in humanity for today - I'm off to look at some comics

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I wonder if the cost and profit making of the US healthcare system makes people hate it, and therefore skeptical of its benefits? Just a thought...

    Roxy222uk
    Community Member
    2 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Tetanus shots are overused though. I once got taken to A&E because I’d fallen on gravel and really scraped up my knee (my friend worked there, I would never have taken myself off for something like that). They cleaned it out and gave me a tetanus vaccination. I then read up on tetanus (this was back in the 80s, so no I was not getting my information from youtubers!) and found out that it is an anaerobic bacteria. Oxygen kills it. It flourishes in deep puncture wounds with very narrow openings, in an anaerobic environment. It absolutely will not cause any kind of problem in a very shallow, open, graze. The vaccine was completely unnecessary and, considering *all* medical interventions carry some risk, I was put at more risk by having it than not. I was annoyed, to say the least. Yes tetanus exists, but most of the injuries that are treated with a shot do not require it. Also, why was the NHS wasting money?

    Phil Green
    Community Member
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I don't think either of them understand that tetanus and a tetanus vaccine are two different things.

    Armac
    Community Member
    Premium
    5 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    The narrator said *his doctor said nothing of the sort

    Debby Keir
    Community Member
    1 hour ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    You get one injection at the time of injury - a weakened but live form of the disease, which works quickly but only gives shortlived cover (and is usually painful and makes you feel unwell) But then you have a course of 3 vaccines over a period of around 9 months, which lasts for 5 years (so you wouldn't need the painful one again) If you have a booster after 5 years, then you should actually be covered for life. (Exact details depends on your country's vaccination schedule/green book in the UK)

    #74

    Tweet falsely spreading medical knowledge about cancer toxins and chemotherapy, drawing criticism for misinformation.

    BadMedicalTakes Report

    Razill
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ok - so how do u explain "blood cancers" (leukemias) that dont have "tumors"? This world is doomed

    V
    Community Member
    13 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    They're just from having a negative personality according to this type.

    Load More Replies...
    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Prove it. Get hold of some tumors, and tell me: Why do tumors have cells in them? Why are they mostly made of cells? Why do those cells have exceptionally high genetic instability? Why do genes involved in DNA repair, cell proliferation and adhesion tend to be damaged in tumor cells? Why do people with tumors die more quickly if they have low immune cell infiltration. I very much appreciate your expertise.

    #75

    Social media post joking about a child's only doctor being a chiropractor, linked to spreading medical knowledge.

    BadMedicalTakes Report

    LakotaWolf (she/her)
    Community Member
    Premium
    7 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Chiropractors aren't doctors.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh, another weird American obsession. In the UK chiropractors are registered and as respected as osteopaths (or do Americans hate osteopaths too?).

    #76

    Screenshot of a social media post sharing misinformation about skipping a newborn's hearing test, spreading incorrect medical knowledge.

    BadMedicalTakes Report

    Multa Nocte
    Community Member
    Premium
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Thomas the Train appears to have derailed.

    Greymom
    Community Member
    9 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Oh Thomas. I feel so sad for your children.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Well, are you in the USA and these tests are very expensive? You could just say that, rather than suggesting putting headphones on your child for a minute so you can know if it has hearing is a bad idea.

    #77

    Screenshot of a Twitter exchange spreading questionable medical knowledge about cancer research funding and cures.

    BadMedicalTakes Report

    Nathaniel He/Him Cis-Het
    Community Member
    Premium
    15 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Or... Cancer is not one disease but is an umbrella term covering a wide range of diseases all of which need their own treatment and cures...

    Ace
    Community Member
    Premium
    6 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    There are in fact quite a significant number of treatments that can cure certain forms of cancer. I was privileged to have some input into the analysis and approval process of one of the early ones, really the first one accepted as a full cure, which has now gone on to save something like 5 million women who would otherwise have died from breast cancer.

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Erm, well yes, they get paid A LOT of money if they find a cure. Some might say... billions. Jenn needs a filter or people might realise she's a bit thick. Maybe a cure hasn't been found because (a) cancer is not 1 but 1000s of different diseases. (b) the tools and technology we have to explore it are highly limited. Its tricky to explore trillions of interactions at the molecular level in real time, for thousands of people (c) cancer is heterogenous, which means its a little different in everyone.

    #78

    Tweet claiming infertility is not a medical condition and IVF doesn't treat anything, spreading medical misinformation online.

    BadMedicalTakes Report

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What the heck is it if not a medical condition? An artistic choice?

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A part of your body not functioning as it should isn’t a medical problem?

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Why is educating your dumb children *my* cost burden? Oh, wait, maybe because all of that stuff can be much less of a burden for everybody if it is shared out and we all chip in for the benefit of our country as a whole rather than any specific individual?

    Greymom
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    And yet these are the same people who believe it’s a woman’s sole job to push out as many kids as possible and help increase the US population. ( or at least a “ certain” segment of it that just might happen to look a “certain” shade of pale)🙄🙄

    Multa Nocte
    Community Member
    Premium
    3 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Amen, sister, and hallelujah!!!!!!

    Load More Replies...
    #79

    Screenshot of a tweet sharing a controversial medical claim about tattoos and autism, highlighting misinformation and shaming.

    BadMedicalTakes Report

    Charlotte
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    One of my theories is that chocolate cake in large quantities is good for me. We can all make up theories

    LB
    Community Member
    6 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    I volunteer to help with the research!

    Load More Replies...
    Greymom
    Community Member
    8 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Thank God I didn’t get my first tattoo until I was over 50 and through birthin’ children!🤣

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That's a fun theory. Prove it. I wouldn't be too tricky to test it out. Interview a few thousand people who have children. Ask who had tatoo's before pregnancy and whether their kids have autism. Then, look at the numbers. Now the tricky bit, if it shows there is no difference, please be honest.

    Roxy222uk
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    That’s not a theory, that’s a hypothesis. And a ruddy hilarious one at that.

    Auntriarch
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Ah, if only more people understood the difference

    Load More Replies...
    #80

    Screenshot of a social media post spreading medical misinformation, reflecting the theme of medical knowledge shaming.

    BadMedicalTakes Report

    GenericElder
    Community Member
    14 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Stupid and a racist - well, same thing really.

    emorinelli49
    Community Member
    14 hours ago

    This comment is hidden. Click here to view.

    We are all one race - the human race. Color is just a decoration. We all look the same inside. You are a stupid fool.

    TotallyNOTAFox
    Community Member
    12 hours ago (edited) Created by potrace 1.15, written by Peter Selinger 2001-2017

    Sure, let's ignore the f*****g fact that asians, american natives and the australian aboriginies also have Neanderthal DNA traces. The only population not having that are native, sub-saharan africans due to the geographical seperation between their ancestors and the Neanderthals

    I am John
    Community Member
    1 hour ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    A picture of Sauron the Deceiver. Appropriate.

    Rick Murray
    Community Member
    2 hours ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    Don't tell this person the "out of Africa" theory of human evolution, or mention that there's a pretty good chance that Jesus would look more like Yasser Arafat than Chuck Norris.

    Roxy222uk
    Community Member
    57 minutes ago Created by potrace 1.15, written by Peter Selinger 2001-2017

    What? How does that even make sense to other racists?